Lineage for d3crxa1 (3crx A:19-129)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153720Fold a.60: SAM domain-like [47768] (11 superfamilies)
  4. 153964Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) (S)
  5. 153965Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 153966Protein Cre recombinase [47825] (1 species)
  7. 153967Species Bacteriophage P1 [TaxId:10678] [47826] (8 PDB entries)
  8. 153977Domain d3crxa1: 3crx A:19-129 [18101]
    Other proteins in same PDB: d3crxa2, d3crxb2

Details for d3crxa1

PDB Entry: 3crx (more details), 2.5 Å

PDB Description: cre recombinase/dna complex intermediate i

SCOP Domain Sequences for d3crxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3crxa1 a.60.9.1 (A:19-129) Cre recombinase {Bacteriophage P1}
tsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllyl
qarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOP Domain Coordinates for d3crxa1:

Click to download the PDB-style file with coordinates for d3crxa1.
(The format of our PDB-style files is described here.)

Timeline for d3crxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3crxa2