Lineage for d2crxa1 (2crx A:19-129)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356779Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 357068Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) (S)
  5. 357069Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 357070Protein Cre recombinase [47825] (1 species)
  7. 357071Species Bacteriophage P1 [TaxId:10678] [47826] (16 PDB entries)
  8. 357079Domain d2crxa1: 2crx A:19-129 [18099]
    Other proteins in same PDB: d2crxa2, d2crxb2

Details for d2crxa1

PDB Entry: 2crx (more details), 2.5 Å

PDB Description: structure of the holliday junction intermediate in cre-loxp site-specific recombination

SCOP Domain Sequences for d2crxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2crxa1 a.60.9.1 (A:19-129) Cre recombinase {Bacteriophage P1}
tsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllyl
qarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOP Domain Coordinates for d2crxa1:

Click to download the PDB-style file with coordinates for d2crxa1.
(The format of our PDB-style files is described here.)

Timeline for d2crxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2crxa2