SCOPe 2.08: Domain d3ma2c_: 3ma2 C:

Lineage for d3ma2c_ (3ma2 C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.3: TIMP-like [50242] (4 families)

5. Family b.40.3.1: Tissue inhibitor of metalloproteinases, TIMP [50243] (2 proteins)
   contains an irregular alpha+beta subdomain in the C-terminal extension
   automatically mapped to Pfam PF00965

6. Protein TIMP-1 [50244] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50245] (8 PDB entries)

8. Domain d3ma2c_: 3ma2 C: [180983]
   Other proteins in same PDB: d3ma2a_, d3ma2d_
   automated match to d1d2ba_
   complexed with ca, zn

Details for d3ma2c_

PDB Entry: 3ma2, 2.05 Å

PDB Description: complex membrane type-1 matrix metalloproteinase (mt1-mmp) with tissue inhibitor of metalloproteinase-1 (timp-1)

PDB Compounds: (C:) Metalloproteinase inhibitor 1

SCOPe Domain Sequences for d3ma2c_:

Sequence, based on SEQRES records:

>d3ma2c_ b.40.3.1 (C:) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]}
ctcapvhpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
vytpamesvcgyfhrshnrseefliagklqdgllhitlcsfvapwnslslaqrrgftkty
tvgc

Sequence, based on observed residues (ATOM records):

>d3ma2c_ b.40.3.1 (C:) TIMP-1 {Human (Homo sapiens) [TaxId: 9606]}
ctcapvhpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqaadirfvytp
amesvcgyfhrsnrseefliagklqdgllhitlcsfvapwnslslaqrrgftktytvgc

Timeline for d3ma2c_:

• d3ma2c_ first appeared in SCOPe 2.01
  
• d3ma2c_ appears in SCOPe 2.07