| Class b: All beta proteins [48724] (176 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
| Family b.34.13.0: automated matches [191621] (1 protein) not a true family |
| Protein automated matches [191139] (3 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189399] (4 PDB entries) |
| Domain d3m9qb_: 3m9q B: [180977] automated match to d2efia1 protein/DNA complex |
PDB Entry: 3m9q (more details), 1.29 Å
SCOPe Domain Sequences for d3m9qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m9qb_ b.34.13.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lrdetplfhkgeivlcyepdkskarvlytskvlnvferrnehglrfyeykihfqgwrpsy
dravratvllkdteenrqlqrelaeaa
Timeline for d3m9qb_: