Lineage for d4crxa1 (4crx A:20-129)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 98579Fold a.60: SAM domain-like [47768] (11 superfamilies)
  4. 98807Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) (S)
  5. 98808Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 98809Protein Cre recombinase [47825] (1 species)
  7. 98810Species Bacteriophage P1 [TaxId:10678] [47826] (7 PDB entries)
  8. 98812Domain d4crxa1: 4crx A:20-129 [18095]
    Other proteins in same PDB: d4crxa2, d4crxb2

Details for d4crxa1

PDB Entry: 4crx (more details), 2.2 Å

PDB Description: asymmetric dna-bending in the cre-loxp site-specific recombination synapse

SCOP Domain Sequences for d4crxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4crxa1 a.60.9.1 (A:20-129) Cre recombinase {Bacteriophage P1}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOP Domain Coordinates for d4crxa1:

Click to download the PDB-style file with coordinates for d4crxa1.
(The format of our PDB-style files is described here.)

Timeline for d4crxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4crxa2