| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) ![]() |
| Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) |
| Protein Flap endonuclease-1 (Fen-1 nuclease) [47815] (5 species) |
| Species Methanococcus jannaschii [TaxId:2190] [47816] (2 PDB entries) |
| Domain d1a77a1: 1a77 A:209-316 [18090] Other proteins in same PDB: d1a77a2 complexed with mg |
PDB Entry: 1a77 (more details), 2 Å
SCOPe Domain Sequences for d1a77a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a77a1 a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nuclease) {Methanococcus jannaschii [TaxId: 2190]}
islddlidiaifmgtdynpggvkgigfkrayelvrsgvakdvlkkeveyydeikrifkep
kvtdnyslslklpdkegiikflvdendfnydrvkkhvdklynliankt
Timeline for d1a77a1: