![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein Hemagglutinin [49824] (22 species) includes rudiment esterase domain |
![]() | Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries) |
![]() | Domain d3m6sa1: 3m6s A:1-322 [180895] Other proteins in same PDB: d3m6sa2, d3m6sb_, d3m6sc2, d3m6sd_, d3m6se2, d3m6sf_, d3m6sh_, d3m6si2, d3m6sj_, d3m6sl_ automated match to d1rd8a_ complexed with nag |
PDB Entry: 3m6s (more details), 2.8 Å
SCOPe Domain Sequences for d3m6sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m6sa1 b.19.1.2 (A:1-322) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw ilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpkt sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih hpstsadqqslyqnadayvfvgtskyskkfkpeiairpkvrdqegrmnyywtlvepgdki tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti gkcpkyvkstklrlatglrnvp
Timeline for d3m6sa1: