Lineage for d3m6sb_ (3m6s B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041265Domain d3m6sb_: 3m6s B: [239457]
    Other proteins in same PDB: d3m6sa1, d3m6sa2, d3m6sc1, d3m6sc2, d3m6se1, d3m6se2, d3m6sg_, d3m6si1, d3m6si2, d3m6sk_
    automated match to d4n5zb_
    complexed with nag

Details for d3m6sb_

PDB Entry: 3m6s (more details), 2.8 Å

PDB Description: crystal structure of h1n1pdm hemagglutinin
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d3m6sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m6sb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
qftavgkefnhlekrienlnkkiddgfldiwtynaellvllenertldyhdsnvknlyek
vrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnr

SCOPe Domain Coordinates for d3m6sb_:

Click to download the PDB-style file with coordinates for d3m6sb_.
(The format of our PDB-style files is described here.)

Timeline for d3m6sb_: