Lineage for d3m5rb1 (3m5r B:79-203)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010233Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 3010234Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
    automatically mapped to Pfam PF00600
  5. 3010235Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
    C-terminal part of Pfam PF00600
  6. 3010240Protein automated matches [190936] (7 species)
    not a true protein
  7. 3010241Species Influenza A virus (a/california/07/2009(h1n1)) [TaxId:641809] [189299] (1 PDB entry)
  8. 3010243Domain d3m5rb1: 3m5r B:79-203 [180873]
    Other proteins in same PDB: d3m5ra2, d3m5rb2
    automated match to d2gx9a1

Details for d3m5rb1

PDB Entry: 3m5r (more details), 2 Å

PDB Description: crystal structure of swine flu virus ns1 effector domain from h1n1 influenza a/california/07/2009
PDB Compounds: (B:) nonstructural protein 1

SCOPe Domain Sequences for d3m5rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m5rb1 d.299.1.1 (B:79-203) automated matches {Influenza A virus (a/california/07/2009(h1n1)) [TaxId: 641809]}
mtiasvptsrylsdmtleemsrdwfmlmprqkiigplcvrldqaimeknivlkanfsvif
nrletlillrafteegaivgeisplpslpghtyedvknavgvligglewngntvrvseni
qrfaw

SCOPe Domain Coordinates for d3m5rb1:

Click to download the PDB-style file with coordinates for d3m5rb1.
(The format of our PDB-style files is described here.)

Timeline for d3m5rb1: