![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
![]() | Protein automated matches [190710] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187857] (25 PDB entries) |
![]() | Domain d3m5bb_: 3m5b B: [180860] automated match to d1buoa_ |
PDB Entry: 3m5b (more details), 2 Å
SCOPe Domain Sequences for d3m5bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m5bb_ d.42.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pirlpspygsdrlvqlaarlrpalcdtlitvgsqefpahslvlagvsqqlgrrgqwalge gispstfaqllnfvygesvelqpgelrplqeaaralgvqsleeacwrar
Timeline for d3m5bb_: