SCOPe 2.04: Domain d3m5ba_: 3m5b A:

Lineage for d3m5ba_ (3m5b A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (21 PDB entries)

8. Domain d3m5ba_: 3m5b A: [180859]
   automated match to d1buoa_

Details for d3m5ba_

PDB Entry: 3m5b, 2 Å

PDB Description: Crystal structure of the BTB domain from FAZF/ZBTB32

PDB Compounds: (A:) Zinc finger and BTB domain-containing protein 32

SCOPe Domain Sequences for d3m5ba_:

Sequence; same for both SEQRES and ATOM records:

>d3m5ba_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pirlpspygsdrlvqlaarlrpalcdtlitvgsqefpahslvlagvsqqlgrrgqwalge
gispstfaqllnfvygesvelqpgelrplqeaaralgvqsleeacwrar

Timeline for d3m5ba_:

• d3m5ba_ first appeared in SCOPe 2.01
  
• d3m5ba_ appears in SCOPe 2.03
  
• d3m5ba_ appears in SCOPe 2.05
  
• d3m5ba_ appears in the current release, SCOPe 2.08