| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
Superfamily f.6.1: Leukocidin-like [56959] (3 families) ![]() |
| Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins) heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit automatically mapped to Pfam PF07968 |
| Protein Alpha-hemolysin [56961] (2 species) |
| Species Staphylococcus aureus [TaxId:1280] [56962] (5 PDB entries) |
| Domain d3m4dd_: 3m4d D: [180831] automated match to d7ahla_ mutant |
PDB Entry: 3m4d (more details), 1.9 Å
SCOPe Domain Sequences for d3m4dd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m4dd_ f.6.1.1 (D:) Alpha-hemolysin {Staphylococcus aureus [TaxId: 1280]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeynstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn
Timeline for d3m4dd_: