![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) ![]() |
![]() | Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) |
![]() | Protein 5' to 3' exonuclease domain of DNA polymerase Taq [47811] (1 species) |
![]() | Species Thermus aquaticus [TaxId:271] [47812] (3 PDB entries) |
![]() | Domain d1taqa1: 1taq A:174-289 [18082] Other proteins in same PDB: d1taqa2, d1taqa3, d1taqa4 complexed with bgl, zn |
PDB Entry: 1taq (more details), 2.4 Å
SCOPe Domain Sequences for d1taqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1taqa1 a.60.7.1 (A:174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]} lrpdqwadyraltgdesdnlpgvkgigektarklleewgsleallknldrlkpairekil ahmddlklswdlakvrtdlplevdfakrrepdrerlraflerlefgsllhefglle
Timeline for d1taqa1: