Lineage for d1taq_1 (1taq 174-289)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356779Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 357023Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family) (S)
  5. 357024Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 357025Protein 5' to 3' exonuclease domain of DNA polymerase Taq [47811] (1 species)
  7. 357026Species Thermus aquaticus [TaxId:271] [47812] (4 PDB entries)
  8. 357029Domain d1taq_1: 1taq 174-289 [18082]
    Other proteins in same PDB: d1taq_2, d1taq_3, d1taq_4
    complexed with bgl, zn; mutant

Details for d1taq_1

PDB Entry: 1taq (more details), 2.4 Å

PDB Description: structure of taq dna polymerase

SCOP Domain Sequences for d1taq_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1taq_1 a.60.7.1 (174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus}
lrpdqwadyraltgdesdnlpgvkgigektarklleewgsleallknldrlkpairekil
ahmddlklswdlakvrtdlplevdfakrrepdrerlraflerlefgsllhefglle

SCOP Domain Coordinates for d1taq_1:

Click to download the PDB-style file with coordinates for d1taq_1.
(The format of our PDB-style files is described here.)

Timeline for d1taq_1: