SCOP 1.67: Domain d1taq_1: 1taq 174-289

Lineage for d1taq_1 (1taq 174-289)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein 5' to 3' exonuclease domain of DNA polymerase Taq [47811] (1 species)

7. Species Thermus aquaticus [TaxId:271] [47812] (4 PDB entries)

8. Domain d1taq_1: 1taq 174-289 [18082]
   Other proteins in same PDB: d1taq_2, d1taq_3, d1taq_4
   complexed with bgl, zn; mutant

Details for d1taq_1

PDB Entry: 1taq, 2.4 Å

PDB Description: structure of taq dna polymerase

SCOP Domain Sequences for d1taq_1:

Sequence; same for both SEQRES and ATOM records:

>d1taq_1 a.60.7.1 (174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus}
lrpdqwadyraltgdesdnlpgvkgigektarklleewgsleallknldrlkpairekil
ahmddlklswdlakvrtdlplevdfakrrepdrerlraflerlefgsllhefglle

Timeline for d1taq_1:

• d1taq_1 first appeared (with stable ids) in SCOP 1.55
  
• d1taq_1 appears in SCOP 1.65
  
• d1taq_1 appears in SCOP 1.69
  
• d1taq_1 appears in the current release, SCOPe 2.08, called d1taqa1