Lineage for d3m47a_ (3m47 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1143706Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1143783Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 1143927Protein automated matches [190130] (9 species)
    not a true protein
  7. 1143993Species Methanothermobacter thermautotrophicus [TaxId:187420] [188934] (53 PDB entries)
  8. 1143998Domain d3m47a_: 3m47 A: [180818]
    automated match to d1dv7a_
    complexed with gol; mutant

Details for d3m47a_

PDB Entry: 3m47 (more details), 1.2 Å

PDB Description: crystal structure of the mutant i218a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3m47a_:

Sequence, based on SEQRES records: (download)

>d3m47a_ c.1.2.3 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
rvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfg
criiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfllt
emshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvga
qggdpgetlrfadaiivgrsiyladnpaaaaagaiesi

Sequence, based on observed residues (ATOM records): (download)

>d3m47a_ c.1.2.3 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
rvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfg
criiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfllt
emshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgetl
rfadaiivgrsiyladnpaaaaagaiesi

SCOPe Domain Coordinates for d3m47a_:

Click to download the PDB-style file with coordinates for d3m47a_.
(The format of our PDB-style files is described here.)

Timeline for d3m47a_: