SCOPe 2.02: Domain d3m32c_: 3m32 C:

Lineage for d3m32c_ (3m32 C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)

6. Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (12 PDB entries)

8. Domain d3m32c_: 3m32 C: [180775]
   automated match to d1hbmc_
   complexed with act, com, edo, f43, mg, peg, sht, tp7, zn

Details for d3m32c_

PDB Entry: 3m32, 1.35 Å

PDB Description: structural insight into methyl-coenzyme m reductase chemistry using coenzyme b analogues

PDB Compounds: (C:) Methyl-coenzyme M reductase I subunit gamma

SCOPe Domain Sequences for d3m32c_:

Sequence; same for both SEQRES and ATOM records:

>d3m32c_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl

Timeline for d3m32c_:

• d3m32c_ first appeared in SCOPe 2.01
  
• d3m32c_ appears in SCOPe 2.03
  
• d3m32c_ appears in the current release, SCOPe 2.08