Lineage for d3m2mb_ (3m2m B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2388863Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2388881Protein Galectin-1 [100925] (5 species)
  7. 2388969Species Norway rat (Rattus norvegicus) [TaxId:10116] [190017] (3 PDB entries)
  8. 2388979Domain d3m2mb_: 3m2m B: [180755]
    automated match to d1w6ma_
    complexed with lat

Details for d3m2mb_

PDB Entry: 3m2m (more details), 2.95 Å

PDB Description: rat galectin-1 complex with lactose
PDB Compounds: (B:) galectin-1

SCOPe Domain Sequences for d3m2mb_:

Sequence, based on SEQRES records: (download)

>d3m2mb_ b.29.1.3 (B:) Galectin-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
glvasnlnlkpgeclkvrgelapdaksfvlnlgkdsnnlclhfnprfnahgdantivcns
kddgtwgteqretafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainymaa
dgdfkikcvafe

Sequence, based on observed residues (ATOM records): (download)

>d3m2mb_ b.29.1.3 (B:) Galectin-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
glvasnlnlkpgeclkvrgelapdaksfvlnlgkdsnnlclhfnprfnantivcnskddg
twgteqrepgsitevcitfdqadltiklpdghefkfpnrlnmeainymaadgdfkikcva
fe

SCOPe Domain Coordinates for d3m2mb_:

Click to download the PDB-style file with coordinates for d3m2mb_.
(The format of our PDB-style files is described here.)

Timeline for d3m2mb_: