SCOPe 2.04: Domain d3m2ld_: 3m2l D:

Lineage for d3m2ld_ (3m2l D:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.6: Leukocidin-like [56958] (1 superfamily)
   subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel

4. Superfamily f.6.1: Leukocidin-like [56959] (3 families)

5. Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
   heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
   automatically mapped to Pfam PF07968

6. Protein Alpha-hemolysin [56961] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [56962] (5 PDB entries)

8. Domain d3m2ld_: 3m2l D: [180750]
   automated match to d7ahla_
   mutant

Details for d3m2ld_

PDB Entry: 3m2l, 2.1 Å

PDB Description: crystal structure of the m113f mutant of alpha-hemolysin

PDB Compounds: (D:) alpha-hemolysin

SCOPe Domain Sequences for d3m2ld_:

Sequence; same for both SEQRES and ATOM records:

>d3m2ld_ f.6.1.1 (D:) Alpha-hemolysin {Staphylococcus aureus [TaxId: 1280]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeyfstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

Timeline for d3m2ld_:

• d3m2ld_ first appeared in SCOPe 2.01
  
• d3m2ld_ appears in SCOPe 2.03
  
• d3m2ld_ appears in SCOPe 2.05
  
• d3m2ld_ appears in the current release, SCOPe 2.08