SCOPe 2.08: Domain d3m10b1: 3m10 B:2-95

Lineage for d3m10b1 (3m10 B:2-95)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)

6. Protein Arginine kinase, N-domain [48042] (2 species)

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (14 PDB entries)
   Uniprot P51541

8. Domain d3m10b1: 3m10 B:2-95 [180702]
   Other proteins in same PDB: d3m10a2, d3m10b2
   complexed with so4

Details for d3m10b1

PDB Entry: 3m10, 1.73 Å

PDB Description: substrate-free form of arginine kinase

PDB Compounds: (B:) arginine kinase

SCOPe Domain Sequences for d3m10b1:

Sequence; same for both SEQRES and ATOM records:

>d3m10b1 a.83.1.1 (B:2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
dsgvgiyapdaesyrtfgplfdpiiddyhggfkl

Timeline for d3m10b1:

• d3m10b1 first appeared in SCOPe 2.01
  
• d3m10b1 appears in SCOPe 2.07