Lineage for d3m0qa_ (3m0q A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536114Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. Species Chicken (Gallus gallus) [TaxId:9031] [50059] (34 PDB entries)
  8. 1536147Domain d3m0qa_: 3m0q A: [180685]
    automated match to d1pwta_
    complexed with so4; mutant

Details for d3m0qa_

PDB Entry: 3m0q (more details), 1.75 Å

PDB Description: crystal structure of the r21d mutant of alpha-spectrin sh3 domain. crystal obtained in ammonium sulphate at ph 5.
PDB Compounds: (A:) Spectrin alpha chain, brain

SCOPe Domain Sequences for d3m0qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m0qa_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
elvlalydyqekspdevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkld

SCOPe Domain Coordinates for d3m0qa_:

Click to download the PDB-style file with coordinates for d3m0qa_.
(The format of our PDB-style files is described here.)

Timeline for d3m0qa_: