SCOPe 2.06: Domain d3lx3a_: 3lx3 A:

Lineage for d3lx3a_ (3lx3 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.2: 6-pyruvoyl tetrahydropterin synthase [55625] (2 proteins)

6. Protein automated matches [191141] (1 species)
   not a true protein

7. Species Plasmodium vivax [TaxId:5855] [189269] (3 PDB entries)

8. Domain d3lx3a_: 3lx3 A: [180614]
   automated match to d2a0sa1
   complexed with xtn, zn

Details for d3lx3a_

PDB Entry: 3lx3, 1.55 Å

PDB Description: plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps) in complex with xanthopterin

PDB Compounds: (A:) 6-pyruvoyl tetrahydrobiopterin synthase

SCOPe Domain Sequences for d3lx3a_:

Sequence; same for both SEQRES and ATOM records:

>d3lx3a_ d.96.1.2 (A:) automated matches {Plasmodium vivax [TaxId: 5855]}
dqiaellvesplfsfncahfiafkgfretlhghnynvslrlrgniqgdgyvidfsilkek
vrkvckqldhhfilpmysdvlniqevndnfkitcednseysfpkrdcvqipikhssteei
glyilnqlieeidlpflktrsvnymevtvsespsqkatvhrni

Timeline for d3lx3a_:

• d3lx3a_ first appeared in SCOPe 2.01
  
• d3lx3a_ appears in SCOPe 2.05
  
• d3lx3a_ appears in SCOPe 2.07
  
• d3lx3a_ appears in the current release, SCOPe 2.08