Lineage for d3lwea_ (3lwe A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394630Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2394814Family b.34.13.0: automated matches [191621] (1 protein)
    not a true family
  6. 2394815Protein automated matches [191139] (6 species)
    not a true protein
  7. 2394825Species Human (Homo sapiens) [TaxId:9606] [189257] (7 PDB entries)
  8. 2394831Domain d3lwea_: 3lwe A: [180604]
    automated match to d2dnta1

Details for d3lwea_

PDB Entry: 3lwe (more details), 2.05 Å

PDB Description: the crystal structure of mpp8
PDB Compounds: (A:) M-phase phosphoprotein 8

SCOPe Domain Sequences for d3lwea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lwea_ b.34.13.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gedvfevekildmkteggkvlykvrwkgytsdddtwepeihledckevllefrkkiaenk
a

SCOPe Domain Coordinates for d3lwea_:

Click to download the PDB-style file with coordinates for d3lwea_.
(The format of our PDB-style files is described here.)

Timeline for d3lwea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3lweb_