Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:1063] [189314] (2 PDB entries) |
Domain d3lqfb_: 3lqf B: [180509] automated match to d1vl8b_ complexed with mg, mry, nad |
PDB Entry: 3lqf (more details), 1.8 Å
SCOPe Domain Sequences for d3lqfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lqfb_ c.2.1.0 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} mdyrtvfrldgacaavtgagsgigleicrafaasgarlilidreaaaldraaqelgaava arivadvtdaeamtaaaaeaeavapvsilvnsagiarlhdaletddatwrqvmavnvdgm fwasrafgramvargagaivnlgsmsgtivnrpqfassymaskgavhqltralaaewagr gvrvnalapgyvatemtlkmrerpelfetwldmtpmgrcgepseiaaaalflaspaasyv tgailavdggytvw
Timeline for d3lqfb_: