Lineage for d8icya1 (8icy A:9-91)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153720Fold a.60: SAM domain-like [47768] (11 superfamilies)
  4. 153816Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
  5. 153817Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins)
  6. 153818Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
  7. 153819Species Human (Homo sapiens) [TaxId:9606] [47805] (90 PDB entries)
  8. 153888Domain d8icya1: 8icy A:9-91 [18048]
    Other proteins in same PDB: d8icya2

Details for d8icya1

PDB Entry: 8icy (more details), 3.1 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex + thymidine-5'-triphosphate, soaked in the presence of dttp and mncl2

SCOP Domain Sequences for d8icya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8icya1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

SCOP Domain Coordinates for d8icya1:

Click to download the PDB-style file with coordinates for d8icya1.
(The format of our PDB-style files is described here.)

Timeline for d8icya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d8icya2