Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (27 species) not a true protein |
Species Colwellia psychrerythraea [TaxId:167879] [189235] (1 PDB entry) |
Domain d3lo3l1: 3lo3 L:2-92 [180447] Other proteins in same PDB: d3lo3a2, d3lo3b2, d3lo3c2, d3lo3d2, d3lo3e2, d3lo3f2, d3lo3g2, d3lo3h2, d3lo3i2, d3lo3j2, d3lo3k2, d3lo3l2, d3lo3m2, d3lo3n2, d3lo3o2, d3lo3p2, d3lo3q2, d3lo3r2, d3lo3s2, d3lo3t2, d3lo3u2, d3lo3v2, d3lo3w2, d3lo3x2, d3lo3y2, d3lo3z2 automated match to d2fiua1 complexed with gol |
PDB Entry: 3lo3 (more details), 2.38 Å
SCOPe Domain Sequences for d3lo3l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lo3l1 d.58.4.0 (L:2-92) automated matches {Colwellia psychrerythraea [TaxId: 167879]} tayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilefpsr edaynwyhseeyqalistrdlgmdsqfqlig
Timeline for d3lo3l1:
View in 3D Domains from other chains: (mouse over for more information) d3lo3a1, d3lo3a2, d3lo3b1, d3lo3b2, d3lo3c1, d3lo3c2, d3lo3d1, d3lo3d2, d3lo3e1, d3lo3e2, d3lo3f1, d3lo3f2, d3lo3g1, d3lo3g2, d3lo3h1, d3lo3h2, d3lo3i1, d3lo3i2, d3lo3j1, d3lo3j2, d3lo3k1, d3lo3k2, d3lo3m1, d3lo3m2, d3lo3n1, d3lo3n2, d3lo3o1, d3lo3o2, d3lo3p1, d3lo3p2, d3lo3q1, d3lo3q2, d3lo3r1, d3lo3r2, d3lo3s1, d3lo3s2, d3lo3t1, d3lo3t2, d3lo3u1, d3lo3u2, d3lo3v1, d3lo3v2, d3lo3w1, d3lo3w2, d3lo3x1, d3lo3x2, d3lo3y1, d3lo3y2, d3lo3z1, d3lo3z2 |