Lineage for d3lmxb_ (3lmx B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2769889Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2769890Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2769913Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 2769921Species Pseudomonas putida [TaxId:303] [49487] (36 PDB entries)
  8. 2770091Domain d3lmxb_: 3lmx B: [180399]
    Other proteins in same PDB: d3lmxm_, d3lmxn_, d3lmxo_
    automated match to d1ykka1
    complexed with bme, cl, dhb, fe, gol, so4

Details for d3lmxb_

PDB Entry: 3lmx (more details), 2.2 Å

PDB Description: tyrosine 447 of protocatechuate 34,-dioxygenase controls efficient progress through catalysis
PDB Compounds: (B:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d3lmxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lmxb_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOPe Domain Coordinates for d3lmxb_:

Click to download the PDB-style file with coordinates for d3lmxb_.
(The format of our PDB-style files is described here.)

Timeline for d3lmxb_: