![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
![]() | Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
![]() | Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species) |
![]() | Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries) |
![]() | Domain d3lmxn_: 3lmx N: [180402] Other proteins in same PDB: d3lmxa_, d3lmxb_, d3lmxc_ automated match to d1ykkb1 complexed with bme, cl, dhb, fe, gol, so4 |
PDB Entry: 3lmx (more details), 2.2 Å
SCOPe Domain Sequences for d3lmxn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lmxn_ b.3.6.1 (N:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]} paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld pnfggvgrcltdsdgyysfrtikpgphpwrngpndwrpahihfgisgpsiatklitqlyf egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc
Timeline for d3lmxn_: