Lineage for d3lmbb_ (3lmb B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944385Species Chlorobaculum tepidum [TaxId:194439] [189276] (1 PDB entry)
  8. 2944387Domain d3lmbb_: 3lmb B: [180380]
    automated match to d1t82a_

Details for d3lmbb_

PDB Entry: 3lmb (more details), 2.1 Å

PDB Description: The crystal structure of the protein OLEI01261 with unknown function from Chlorobaculum tepidum TLS
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d3lmbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lmbb_ d.38.1.0 (B:) automated matches {Chlorobaculum tepidum [TaxId: 194439]}
nasltpdqvskklkqffsdhlpisqfmgleiesydgdtliltaplepnindkqtafggsl
ynaavmacwgmvylktqeeniacnqvvtegnmkyiapvygriraichapdeeelanffdh
ferkgkarisleaaiyndacvmkiepetkpsvkfngqyailkn

SCOPe Domain Coordinates for d3lmbb_:

Click to download the PDB-style file with coordinates for d3lmbb_.
(The format of our PDB-style files is described here.)

Timeline for d3lmbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3lmba_