Lineage for d3llrb_ (3llr B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1537363Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1537532Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 1537533Protein automated matches [191144] (3 species)
    not a true protein
  7. 1537543Species Human (Homo sapiens) [TaxId:9606] [189286] (20 PDB entries)
  8. 1537586Domain d3llrb_: 3llr B: [180375]
    automated match to d1khca_
    complexed with btb, so4

Details for d3llrb_

PDB Entry: 3llr (more details), 2.3 Å

PDB Description: crystal structure of the pwwp domain of human dna (cytosine-5-)- methyltransferase 3 alpha
PDB Compounds: (B:) DNA (cytosine-5)-methyltransferase 3A

SCOPe Domain Sequences for d3llrb_:

Sequence, based on SEQRES records: (download)

>d3llrb_ b.34.9.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
peyedgrgfgigelvwgklrgfswwpgrivswwmtgrsraaegtrwvmwfgdgkfsvvcv
eklmplssfcsafhqatynkqpmyrkaiyevlqvassragklfpvchdsdesdtakavev
qnkpmiewalggfqpsgpkglepp

Sequence, based on observed residues (ATOM records): (download)

>d3llrb_ b.34.9.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
peyedgrgfgigelvwgklrgfswwpgrivswwmtgrsraaegtrwvmwfgdgkfsvvcv
eklmplssfcsafhqatynkqpmyrkaiyevlqvassragklfpavevqnkpmiewalgg
fqpsgpkglepp

SCOPe Domain Coordinates for d3llrb_:

Click to download the PDB-style file with coordinates for d3llrb_.
(The format of our PDB-style files is described here.)

Timeline for d3llrb_: