Lineage for d3lktn_ (3lkt N:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1113318Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1113967Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 1113968Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 1114150Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 1114165Species Pseudomonas putida [TaxId:303] [49490] (31 PDB entries)
  8. 1114173Domain d3lktn_: 3lkt N: [180362]
    Other proteins in same PDB: d3lkta_, d3lktb_, d3lktc_, d3lktd_, d3lkte_, d3lktf_
    automated match to d1ykkb1
    complexed with bme, cl, fe, gol, so4, trs

Details for d3lktn_

PDB Entry: 3lkt (more details), 1.65 Å

PDB Description: tyrosine 447 of protocatechuate 3,4-dioxygenase controls efficient progress through catalysis
PDB Compounds: (N:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d3lktn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lktn_ b.3.6.1 (N:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgphpwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc

SCOPe Domain Coordinates for d3lktn_:

Click to download the PDB-style file with coordinates for d3lktn_.
(The format of our PDB-style files is described here.)

Timeline for d3lktn_: