Lineage for d3ljta_ (3ljt A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1661658Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 1661659Protein automated matches [190805] (12 species)
    not a true protein
  7. 1661678Species Human (Homo sapiens) [TaxId:9606] [188286] (26 PDB entries)
  8. 1661687Domain d3ljta_: 3ljt A: [180330]
    automated match to d1r54a_
    complexed with ca, edo, la3, zn

Details for d3ljta_

PDB Entry: 3ljt (more details), 1.6 Å

PDB Description: crystal structure of the catalytic domain of adamts-5 in complex with an amino-2-indanol compound
PDB Compounds: (A:) A disintegrin and metalloproteinase with thrombospondin motifs 5

SCOPe Domain Sequences for d3ljta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ljta_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asrarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvvlg
dkdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlgma
dvgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlmssi
ltsidaskpwskctsatiteflddghgnclldlprkqi

SCOPe Domain Coordinates for d3ljta_:

Click to download the PDB-style file with coordinates for d3ljta_.
(The format of our PDB-style files is described here.)

Timeline for d3ljta_: