SCOPe 2.01: Domain d3l98b_: 3l98 B:

Lineage for d3l98b_ (3l98 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (2 families)

5. Family a.103.1.1: Citrate synthase [48257] (2 proteins)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain

6. Protein automated matches [190675] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189640] (4 PDB entries)

8. Domain d3l98b_: 3l98 B: [180106]
   automated match to d1k3pa_
   complexed with nad, so4

Details for d3l98b_

PDB Entry: 3l98, 2.3 Å

PDB Description: structural determination of the a50t:s279g:s280k:v281k:k282e:h283n variant of citrate synthase from e. coli complexed with nadh

PDB Compounds: (B:) citrate synthase

SCOPe Domain Sequences for d3l98b_:

Sequence; same for both SEQRES and ATOM records:

>d3l98b_ a.103.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftsttsceskitfid
gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtrhtmiheqitrl
fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi
gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt
agssganpfaciaagiaslwgpahgganeaalkmleeigkkenipefvrrakdkndsfrl
mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn
vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf
ksdikr

Timeline for d3l98b_:

• d3l98b_ is new in SCOPe 2.01-stable
  
• d3l98b_ last appears in SCOPe 2.02