Class a: All alpha proteins [46456] (285 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families) |
Family a.7.2.0: automated matches [191602] (1 protein) not a true family |
Protein automated matches [191097] (4 species) not a true protein |
Species Streptococcus mutans [TaxId:1309] [189195] (1 PDB entry) |
Domain d3l8re_: 3l8r E: [180088] automated match to d1e2aa_ |
PDB Entry: 3l8r (more details), 2.5 Å
SCOPe Domain Sequences for d3l8re_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l8re_ a.7.2.0 (E:) automated matches {Streptococcus mutans [TaxId: 1309]} mnteelqvaafeiilnsgnarsivheafdamreknyilaeqklqeandellkahqaqtdl lqeyasgteikieiimvhaqdhlmttmtlrevaiemlelykk
Timeline for d3l8re_: