SCOPe 2.04: Domain d3l60a_: 3l60 A:

Lineage for d3l60a_ (3l60 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families)

5. Family c.43.1.0: automated matches [191456] (1 protein)
   not a true family

6. Protein automated matches [190703] (5 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189181] (1 PDB entry)

8. Domain d3l60a_: 3l60 A: [179993]
   automated match to d1b5sa_
   complexed with unl

Details for d3l60a_

PDB Entry: 3l60, 2 Å

PDB Description: crystal structure of branched-chain alpha-keto acid dehydrogenase subunit e2 from mycobacterium tuberculosis

PDB Compounds: (A:) branched-chain alpha-keto acid dehydrogenase

SCOPe Domain Sequences for d3l60a_:

Sequence; same for both SEQRES and ATOM records:

>d3l60a_ c.43.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pdvrpvhgvharmaekmtlshkeiptakasvevicaellrlrdrfvsaapeitpfaltlr
llvialkhnvilnstwvdsgegpqvhvhrgvhlgfgaatergllvpvvtdaqdkntrela
srvaelitgaregtltpaelrgstftvsnfgalgvddgvpvinhpeaailglgaikprpv
vvggevvarptmtltcvfdhrvvdgaqvaqfmcelrdliespetalldl

Timeline for d3l60a_:

• d3l60a_ first appeared in SCOPe 2.01
  
• d3l60a_ appears in SCOPe 2.03
  
• d3l60a_ appears in SCOPe 2.05
  
• d3l60a_ appears in the current release, SCOPe 2.08