SCOPe 2.02: Domain d3l4pa2: 3l4p A:1-80

Lineage for d3l4pa2 (3l4p A:1-80)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)

6. Protein Aldehyde oxidoreductase, N-terminal domain [54315] (2 species)

7. Species Desulfovibrio gigas [TaxId:879] [54316] (3 PDB entries)
   Uniprot Q46509

8. Domain d3l4pa2: 3l4p A:1-80 [179943]
   Other proteins in same PDB: d3l4pa1, d3l4pa3, d3l4pa4
   automatically matched to d1sija2
   complexed with ast, ca, cl, fes, ipa, li, mg, pcd, ure

Details for d3l4pa2

PDB Entry: 3l4p, 1.45 Å

PDB Description: crystal structure of the aldehyde dehydrogenase (a.k.a. aor or mop) of desulfovibrio gigas covalently bound to [aso3]-

PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d3l4pa2:

Sequence; same for both SEQRES and ATOM records:

>d3l4pa2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]}
miqkvitvngieqnlfvdaeallsdvlrqqlgltgvkvgceqgqcgacsvildgkvvrac
vtkmkrvadgaqittiegvg

Timeline for d3l4pa2:

• d3l4pa2 first appeared in SCOPe 2.01
  
• d3l4pa2 appears in SCOPe 2.03
  
• d3l4pa2 appears in the current release, SCOPe 2.08