Lineage for d3l33d_ (3l33 D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1794264Protein Trypsin(ogen) [50515] (9 species)
  7. 1794723Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (9 PDB entries)
  8. 1794743Domain d3l33d_: 3l33 D: [179895]
    Other proteins in same PDB: d3l33e_, d3l33f_, d3l33g_, d3l33h_
    automated match to d1h4wa_
    complexed with ca, fmt

Details for d3l33d_

PDB Entry: 3l33 (more details), 2.48 Å

PDB Description: Human mesotrypsin complexed with amyloid precursor protein inhibitor(APPI)
PDB Compounds: (D:) Trypsin-3

SCOPe Domain Sequences for d3l33d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l33d_ b.47.1.2 (D:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]}
ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans

SCOPe Domain Coordinates for d3l33d_:

Click to download the PDB-style file with coordinates for d3l33d_.
(The format of our PDB-style files is described here.)

Timeline for d3l33d_: