Class a: All alpha proteins [46456] (286 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (33 species) not a true protein |
Species Campylobacter jejuni [TaxId:192222] [189193] (1 PDB entry) |
Domain d3kwod_: 3kwo D: [179758] automated match to d1ji4a_ complexed with acy, bu1, gol, zn |
PDB Entry: 3kwo (more details), 1.99 Å
SCOPe Domain Sequences for d3kwod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kwod_ a.25.1.0 (D:) automated matches {Campylobacter jejuni [TaxId: 192222]} amsvtkqllqmqadahhlwvkfhnyhwnvkglqffsiheytekayeemaelfdscaervl qlgekaitcqkvlmenakspkvakdcftplevielikqdyeyllaefkklneaaekesdt ttaafaqeniakyekslwmigatlqgac
Timeline for d3kwod_: