Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins) contains Pfam PF00788 and Pfam PF02196 |
Protein automated matches [190541] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187513] (3 PDB entries) |
Domain d3kudb_: 3kud B: [179712] Other proteins in same PDB: d3kuda_ automated match to d1c1yb_ complexed with gdp, mg |
PDB Entry: 3kud (more details), 2.15 Å
SCOPe Domain Sequences for d3kudb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kudb_ d.15.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ntirvflpnkqrtvvnvrngmslhdclmkklkvrglqpeccavfrllhehkgkkarldwn tdaasligeelqvdfl
Timeline for d3kudb_: