SCOPe 2.04: Domain d1ci4a_: 1ci4 A:

Lineage for d1ci4a_ (1ci4 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family)
   contains one classic and one pseudo HhH motifs
   automatically mapped to Pfam PF02961

5. Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (1 protein)

6. Protein Barrier-to-autointegration factor, BAF [47800] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47801] (7 PDB entries)

8. Domain d1ci4a_: 1ci4 A: [17970]
   protein/DNA complex

Details for d1ci4a_

PDB Entry: 1ci4, 1.9 Å

PDB Description: the crystal structure of human barrier-to-autointegration factor (baf)

PDB Compounds: (A:) protein (barrier-to-autointegration factor (baf))

SCOPe Domain Sequences for d1ci4a_:

Sequence; same for both SEQRES and ATOM records:

>d1ci4a_ a.60.5.1 (A:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens) [TaxId: 9606]}
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl

Timeline for d1ci4a_:

• d1ci4a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ci4a_ appears in SCOPe 2.03
  
• d1ci4a_ appears in SCOPe 2.05
  
• d1ci4a_ appears in the current release, SCOPe 2.08