Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.2: Cystatins [54407] (7 proteins) automatically mapped to Pfam PF00031 |
Protein Cystatin A (stefin A) [54412] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54413] (12 PDB entries) |
Domain d3ksee_: 3kse E: [179643] automated match to d1dvca_ |
PDB Entry: 3kse (more details), 1.71 Å
SCOPe Domain Sequences for d3ksee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ksee_ d.17.1.2 (E:) Cystatin A (stefin A) {Human (Homo sapiens) [TaxId: 9606]} mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf
Timeline for d3ksee_: