SCOPe 2.08: Domain d3kpha_: 3kph A:

Lineage for d3kpha_ (3kph A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.202: Superantigen MAM [101343] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.202.1: Superantigen MAM [101344] (1 family)
   automatically mapped to Pfam PF09245

5. Family a.202.1.1: Superantigen MAM [101345] (2 proteins)

6. Protein automated matches [191155] (1 species)
   not a true protein

7. Species Mycoplasma arthritidis [TaxId:2111] [189326] (1 PDB entry)

8. Domain d3kpha_: 3kph A: [179524]
   automated match to d1r5id_
   complexed with po4

Details for d3kpha_

PDB Entry: 3kph, 2.8 Å

PDB Description: crystal structure of mycoplasma arthritidis-derived mitogen

PDB Compounds: (A:) Superantigen

SCOPe Domain Sequences for d3kpha_:

Sequence; same for both SEQRES and ATOM records:

>d3kpha_ a.202.1.1 (A:) automated matches {Mycoplasma arthritidis [TaxId: 2111]}
qnlnnvvftnkelediynlsnkeetkevlklfklkvnqfyrhafgivndynglleykeif
nmmflklsvvfdtqrkeannveqikrniaildeimakadndlsyfisqnknfqelwdkav
kltkemkiklkgqkldlrdgevainkvrelfgsdknvkelwwfrsllvkgvylikryyeg
dielattsdfakavfe

Timeline for d3kpha_:

• d3kpha_ first appeared in SCOPe 2.01
  
• d3kpha_ appears in SCOPe 2.07