Lineage for d3kovi_ (3kov I:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204555Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 2204556Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 2204557Family d.88.1.1: SRF-like [55456] (5 proteins)
  6. 2204588Protein automated matches [191130] (2 species)
    not a true protein
  7. 2204589Species Human (Homo sapiens) [TaxId:9606] [189221] (3 PDB entries)
  8. 2204597Domain d3kovi_: 3kov I: [179510]
    automated match to d1n6jb_
    protein/DNA complex

Details for d3kovi_

PDB Entry: 3kov (more details), 2.9 Å

PDB Description: structure of mef2a bound to dna reveals a completely folded mads- box/mef2 domain that recognizes dna and recruits transcription co- factors
PDB Compounds: (I:) myocyte-specific enhancer factor 2a

SCOPe Domain Sequences for d3kovi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kovi_ d.88.1.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkyteynephesrtnsdivealnkk

SCOPe Domain Coordinates for d3kovi_:

Click to download the PDB-style file with coordinates for d3kovi_.
(The format of our PDB-style files is described here.)

Timeline for d3kovi_: