| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) ![]() there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members |
| Family c.23.14.0: automated matches [191355] (1 protein) not a true family |
| Protein automated matches [190390] (4 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [189273] (2 PDB entries) |
| Domain d3koua_: 3kou A: [179506] automated match to d2ef1a1 complexed with 2nf, nag, so4 |
PDB Entry: 3kou (more details), 1.78 Å
SCOPe Domain Sequences for d3koua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3koua_ c.23.14.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rwhgagstadfqkiiqercdtytqtirpgsrsrncqairqafmsafiskdpckatkedyn
slinlapptvpcgqqvfwsktkelaheyakrrrlmtledtllgyladglrwcgepgssdl
niwscpdwrkdcrtnylsvfwevlserfaesacntvrvvlngslenafdsmsifgrveap
nlrpqveleawlvhdtgkppsdscsgssirklksildgrnvkfrcmdnlsrdqflqr
Timeline for d3koua_: