Lineage for d3koua_ (3kou A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 983822Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 984019Family c.23.14.0: automated matches [191355] (1 protein)
    not a true family
  6. 984020Protein automated matches [190390] (2 species)
    not a true protein
  7. 984021Species Cow (Bos taurus) [TaxId:9913] [189273] (2 PDB entries)
  8. 984024Domain d3koua_: 3kou A: [179506]
    automated match to d2ef1a1
    complexed with 2nf, nag, so4

Details for d3koua_

PDB Entry: 3kou (more details), 1.78 Å

PDB Description: structural insights into the catalytic mechanism of cd38: evidence for a conformationally flexible covalent enzyme-substrate complex.
PDB Compounds: (A:) CD38 molecule

SCOPe Domain Sequences for d3koua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3koua_ c.23.14.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rwhgagstadfqkiiqercdtytqtirpgsrsrncqairqafmsafiskdpckatkedyn
slinlapptvpcgqqvfwsktkelaheyakrrrlmtledtllgyladglrwcgepgssdl
niwscpdwrkdcrtnylsvfwevlserfaesacntvrvvlngslenafdsmsifgrveap
nlrpqveleawlvhdtgkppsdscsgssirklksildgrnvkfrcmdnlsrdqflqr

SCOPe Domain Coordinates for d3koua_:

Click to download the PDB-style file with coordinates for d3koua_.
(The format of our PDB-style files is described here.)

Timeline for d3koua_: