Lineage for d1d8lb1 (1d8l B:65-140)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 770939Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 770940Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein)
  6. 770941Protein DNA helicase RuvA subunit, middle domain [47783] (3 species)
    tetramer; binds Holliday junction
  7. 770942Species Escherichia coli [TaxId:562] [47784] (5 PDB entries)
  8. 770946Domain d1d8lb1: 1d8l B:65-140 [17949]
    Other proteins in same PDB: d1d8la2, d1d8lb2

Details for d1d8lb1

PDB Entry: 1d8l (more details), 2.5 Å

PDB Description: e. coli holliday junction binding protein ruva nh2 region lacking domain iii
PDB Compounds: (B:) protein (holliday junction DNA helicase ruva)

SCOP Domain Sequences for d1d8lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8lb1 a.60.2.1 (B:65-140) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]}
nkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkktaerl
ivemkdrfkglhgdlf

SCOP Domain Coordinates for d1d8lb1:

Click to download the PDB-style file with coordinates for d1d8lb1.
(The format of our PDB-style files is described here.)

Timeline for d1d8lb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d8lb2