SCOPe 2.08: Domain d1d8lb1: 1d8l B:65-140

Lineage for d1d8lb1 (1d8l B:65-140)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.2: RuvA domain 2-like [47781] (7 families)
   duplication: contains two helix-hairpin-helix (HhH) motifs

5. Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein)

6. Protein DNA helicase RuvA subunit, middle domain [47783] (3 species)
   tetramer; binds Holliday junction

7. Species Escherichia coli [TaxId:562] [47784] (5 PDB entries)

8. Domain d1d8lb1: 1d8l B:65-140 [17949]
   Other proteins in same PDB: d1d8la2, d1d8lb2

Details for d1d8lb1

PDB Entry: 1d8l, 2.5 Å

PDB Description: e. coli holliday junction binding protein ruva nh2 region lacking domain iii

PDB Compounds: (B:) protein (holliday junction DNA helicase ruva)

SCOPe Domain Sequences for d1d8lb1:

Sequence; same for both SEQRES and ATOM records:

>d1d8lb1 a.60.2.1 (B:65-140) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]}
nkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkktaerl
ivemkdrfkglhgdlf

Timeline for d1d8lb1:

• d1d8lb1 first appeared (with stable ids) in SCOP 1.55
  
• d1d8lb1 appears in SCOPe 2.07