SCOPe 2.05: Domain d3kmsa_: 3kms A:

Lineage for d3kmsa_ (3kms A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)

6. Protein Viral RNA polymerase [56695] (17 species)

7. Species Foot-and-mouth disease virus - type c [TaxId:12116] [187085] (9 PDB entries)

8. Domain d3kmsa_: 3kms A: [179455]
   automated match to d1u09a_
   protein/RNA complex; complexed with mg; mutant

Details for d3kmsa_

PDB Entry: 3kms, 2.2 Å

PDB Description: G62S mutant of foot-and-mouth disease virus RNA-polymerase in complex with a template- primer RNA trigonal structure

PDB Compounds: (A:) 3D polymerase

SCOPe Domain Sequences for d3kmsa_:

Sequence; same for both SEQRES and ATOM records:

>d3kmsa_ e.8.1.4 (A:) Viral RNA polymerase {Foot-and-mouth disease virus - type c [TaxId: 12116]}
glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
ksdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgdaaalehh

Timeline for d3kmsa_:

• d3kmsa_ first appeared in SCOPe 2.01
  
• d3kmsa_ appears in SCOPe 2.04
  
• d3kmsa_ is called d3kmsa1 in SCOPe 2.06
  
• d3kmsa_ appears in the current release, SCOPe 2.08, called d3kmsa1