SCOPe 2.01: Domain d3kmdc_: 3kmd C:

Lineage for d3kmdc_ (3kmd C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein automated matches [190198] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186941] (13 PDB entries)

8. Domain d3kmdc_: 3kmd C: [179440]
   automated match to d1gzha_
   protein/DNA complex; complexed with zn

Details for d3kmdc_

PDB Entry: 3kmd, 2.15 Å

PDB Description: crystal structure of the p53 core domain bound to a full consensus site as a self-assembled tetramer

PDB Compounds: (C:) Cellular tumor antigen p53

SCOPe Domain Sequences for d3kmdc_:

Sequence; same for both SEQRES and ATOM records:

>d3kmdc_ b.2.5.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstp
ppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrnt
frhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfe
vrvcacpgrdrrteeenlrk

Timeline for d3kmdc_:

• d3kmdc_ is new in SCOPe 2.01-stable
  
• d3kmdc_ appears in SCOPe 2.02
  
• d3kmdc_ appears in the current release, SCOPe 2.08