Lineage for d3kl2l1 (3kl2 L:37-235)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472415Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2472416Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2472469Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2472470Protein automated matches [190499] (25 species)
    not a true protein
  7. 2472620Species Streptomyces avermitilis [TaxId:33903] [189136] (1 PDB entry)
  8. 2472632Domain d3kl2l1: 3kl2 L:37-235 [179422]
    Other proteins in same PDB: d3kl2a2, d3kl2b2, d3kl2c2, d3kl2d2, d3kl2e2, d3kl2f2, d3kl2g2, d3kl2k2, d3kl2l2
    automated match to d1j2ra_
    complexed with so4

Details for d3kl2l1

PDB Entry: 3kl2 (more details), 2.3 Å

PDB Description: crystal structure of a putative isochorismatase from streptomyces avermitilis
PDB Compounds: (L:) Putative isochorismatase

SCOPe Domain Sequences for d3kl2l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kl2l1 c.33.1.0 (L:37-235) automated matches {Streptomyces avermitilis [TaxId: 33903]}
eldpartaivlieyqneftsdggvlhgavadvmqhtgmlantvavvdaarqagvpimhap
itfaegygeltrhpygilkgvvdgkafvkgtwgaaivdelapvngdiviegkrgldtfas
tnldfilrskgvdtivlggfltnccvestmrtgyergfrvitltdcvaatsqeehnnais
ydfpmfsvpmtsadviaal

SCOPe Domain Coordinates for d3kl2l1:

Click to download the PDB-style file with coordinates for d3kl2l1.
(The format of our PDB-style files is described here.)

Timeline for d3kl2l1: