Lineage for d3khta_ (3kht A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 982188Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 982514Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 982515Protein automated matches [190131] (16 species)
    not a true protein
  7. 982532Species Hahella chejuensis [TaxId:349521] [189109] (1 PDB entry)
  8. 982533Domain d3khta_: 3kht A: [179376]
    automated match to d1k68a_

Details for d3khta_

PDB Entry: 3kht (more details), 2.1 Å

PDB Description: crystal structure of response regulator from hahella chejuensis
PDB Compounds: (A:) Response regulator

SCOPe Domain Sequences for d3khta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3khta_ c.23.1.0 (A:) automated matches {Hahella chejuensis [TaxId: 349521]}
skrvlvvednpddialirrvldrkdihcqlefvdngakalyqvqqakydliildiglpia
ngfevmsavrkpganqhtpiviltdnvsddrakqcmaagassvvdkssnnvtdfygriya
ifsywltvnhcq

SCOPe Domain Coordinates for d3khta_:

Click to download the PDB-style file with coordinates for d3khta_.
(The format of our PDB-style files is described here.)

Timeline for d3khta_: